PDB entry 2oxp

View 2oxp on RCSB PDB site
Description: Crystal Structure of Staphylococcal Nuclease mutant V66D/P117G/H124L/S128A
Class: hydrolase
Keywords: nuclease; staphylococcal nuclease, hydrolase
Deposited on 2007-02-20, released 2007-03-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI6
      • engineered (65)
      • engineered (116)
      • engineered (127)
    Domains in SCOPe 2.04: d2oxpa_
  • Heterogens: THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oxpA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmdenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
    heqllrkaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxpA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetvekygpeasaftkkmdenakki
    evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws