PDB entry 2oxn

View 2oxn on RCSB PDB site
Description: Vibrio cholerae family 3 glycoside hydrolase (NagZ) in complex with PUGNAc
Class: hydrolase
Keywords: TIM-barrel, HYDROLASE
Deposited on 2007-02-20, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hexosaminidase
    Species: Vibrio cholerae [TaxId:666]
    Gene: nagZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KU37 (0-329)
      • expression tag (330-332)
    Domains in SCOPe 2.07: d2oxna1, d2oxna2
  • Heterogens: OAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oxnA (A:)
    mgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpilig
    vdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldm
    gfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyde
    retiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgivf
    sddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallkk
    qqfsyselkrlerwqqasanmqrlieqfsehhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxnA (A:)
    mgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpilig
    vdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldm
    gfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyde
    retiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgivf
    sddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallkk
    qqfsyselkrlerwqqasanmqrlieqfsehhh