PDB entry 2oxm

View 2oxm on RCSB PDB site
Description: Crystal structure of a UNG2/modified DNA complex that represent a stabilized short-lived extrahelical state in ezymatic DNA base flipping
Class: Hydrolase/DNA
Keywords: ENZYME DNA COMPLEX, UNG2, URACIL DNA GLYCOSYLASE, Hydrolase-DNA COMPLEX
Deposited on 2007-02-20, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: UNG, DGU, UNG1, UNG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13051 (3-222)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d2oxma2, d2oxma3
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*tp*tp*ap*tp*cp*tp*t)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*tp*(4mf)p*ap*cp*a)-3')
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oxmA (A:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.