PDB entry 2oxh

View 2oxh on RCSB PDB site
Description: The SOXYZ Complex of Paracoccus Pantotrophus
Class: transport protein
Keywords: immunoglobulin-like beta-sandwich fold, transport protein
Deposited on 2007-02-20, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SoxZ protein
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: soxZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LCU8 (0-106)
  Domains in SCOPe 2.07: d2oxha_
• Chain 'B':
  Compound: SoxY protein
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: soxY
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LCU9 (11-123)
    • expression tag (9)
    • cloning artifact (10-11)
    • modified residue (121)
• Chain 'C':
  Compound: SoxZ protein
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: soxZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LCU8 (0-106)
  Domains in SCOPe 2.07: d2oxhc_
• Chain 'D':
  Compound: SoxY protein
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: soxY
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LCU9
    • modified residue (121)
• Chain 'E':
  Compound: SoxZ protein
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: soxZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LCU8 (0-106)
  Domains in SCOPe 2.07: d2oxhe_
• Chain 'F':
  Compound: SoxY protein
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: soxY
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LCU9 (11-123)
    • cloning artifact (10-11)
    • modified residue (121)
• Chain 'Y':
  Compound: SoxY protein
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: soxY
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LCU9 (11-End)
    • cloning artifact (11)
    • modified residue (121)
• Chain 'Z':
  Compound: SoxZ protein
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: soxZ
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LCU8 (0-106)
  Domains in SCOPe 2.07: d2oxhz_
• Heterogens: EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oxhA (A:)
  addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
  vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oxhC (C:)
  addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
  vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oxhE (E:)
  addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
  vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
  

  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'Y':
  No sequence available.
  
  
• Chain 'Z':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oxhZ (Z:)
  addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
  vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav