PDB entry 2oxg

View 2oxg on RCSB PDB site
Description: The SoxYZ Complex of Paracoccus pantotrophus
Class: transport protein
Keywords: immunoglobulin-like beta-sandwich fold, TRANSPORT PROTEIN
Deposited on 2007-02-20, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.17
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oxga_
  • Chain 'B':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oxgc_
  • Chain 'D':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9
      • cloning artifact (10-11)
      • expression tag (10)
      • cloning artifact (11)
  • Chain 'E':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oxge_
  • Chain 'F':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9 (11-End)
      • cloning artifact (9-10)
      • expression tag (9)
      • cloning artifact (10-11)
  • Chain 'Y':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9
      • cloning artifact (10-11)
      • expression tag (10)
      • cloning artifact (11)
  • Chain 'Z':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oxgz_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oxgA (A:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2oxgC (C:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxgC (C:)
    addakprvkvpssakagetvtvkalishkmesgqrkiprsiinrftcelngvnvvdvaid
    pavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2oxgE (E:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxgE (E:)
    dakprvkvpssakagetvtvkalishkmesgqliprsiinrftcelngvnvvdvaidpav
    stnpyfefdakvdaagefkftwydddgsvyedvkpiava
    

  • Chain 'F':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oxgZ (Z:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava