PDB entry 2oxe

View 2oxe on RCSB PDB site
Description: Structure of the Human Pancreatic Lipase-related Protein 2
Class: hydrolase
Keywords: Glycoprotein, Hydrolase, Lipid degradation, Pancreatic Lipase, Structural Genomics Consortium, SGC
Deposited on 2007-02-20, released 2007-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pancreatic lipase-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PNLIPRP2, PLRP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oxea1, d2oxea2
  • Chain 'B':
    Compound: Pancreatic lipase-related protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PNLIPRP2, PLRP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2oxeb1, d2oxeb2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oxeA (A:)
    aakevcygqlgcfsdekpwagtlqrpvkllpwspedidtrfllytnenpnnfqlitgtep
    dtieasnfqldrktrfiihgfldkaedswpsdmckkmfevekvncicvdwrhgsramytq
    avqnirvvgaetafliqalstqlgysledvhvighslgahtaaeagrrlggrvgritgld
    pagpcfqdepeevrldpsdavfvdvihtdsspivpslgfgmsqkvghldffpnggkempg
    ckknvlstitdidgiwegiggfvscnhlrsfeyysssvlnpdgflgypcasydefqeskc
    fpcpaegcpkmghyadqfkgktsaveqtfflntgesgnftswrykvsvtlsgkekvngyi
    rialygsnenskqyeifkgslkpdashtcaidvdfnvgkiqkvkflwnkrginlsepklg
    asqitvqsgedgteynfcssdtveenvlqslypcefvehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxeA (A:)
    kevcygqlgcfsdekpwagtlqrpvkllpwspedidtrfllytnenpnnfqlitgtepdt
    ieasnfqldrktrfiihgfldkaedswpsdmckkmfevekvncicvdwrhgsramytqav
    qnirvvgaetafliqalstqlgysledvhvighslgahtaaeagrrlggrvgritgldpa
    gpcfqdepeevrldpsdavfvdvihtdsspivpslgfgmsqkvghldffpnggkempgcd
    giwegiggfvscnhlrsfeyysssvlnpdgflgypcasydefqeskcfpcpaegcpkmgh
    yadqfkgktsaveqtfflntgesgnftswrykvsvtlsgkekvngyirialygsnenskq
    yeifkgslkpdashtcaidvdfnvgkiqkvkflwnkepklgasqitvqsgedgteynfcs
    sdtveenvlqslypc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oxeB (B:)
    aakevcygqlgcfsdekpwagtlqrpvkllpwspedidtrfllytnenpnnfqlitgtep
    dtieasnfqldrktrfiihgfldkaedswpsdmckkmfevekvncicvdwrhgsramytq
    avqnirvvgaetafliqalstqlgysledvhvighslgahtaaeagrrlggrvgritgld
    pagpcfqdepeevrldpsdavfvdvihtdsspivpslgfgmsqkvghldffpnggkempg
    ckknvlstitdidgiwegiggfvscnhlrsfeyysssvlnpdgflgypcasydefqeskc
    fpcpaegcpkmghyadqfkgktsaveqtfflntgesgnftswrykvsvtlsgkekvngyi
    rialygsnenskqyeifkgslkpdashtcaidvdfnvgkiqkvkflwnkrginlsepklg
    asqitvqsgedgteynfcssdtveenvlqslypcefvehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oxeB (B:)
    kevcygqlgcfsdekpwagtlqrpvkllpwspedidtrfllytnenpnnfqlitgtepdt
    ieasnfqldrktrfiihgfldkaedswpsdmckkmfevekvncicvdwrhgsramytqav
    qnirvvgaetafliqalstqlgysledvhvighslgahtaaeagrrlggrvgritgldpa
    gpcfqdepeevrldpsdavfvdvihtdsspivpslgfgmsqkvghldffpnggkempgcg
    iggfvscnhlrsfeyysssvlnpdgflgypcasydefqeskcfpcpaegcpkmghyadqf
    kgktsaveqtfflntgesgnftswrykvsvtlsgkekvngyirialygsnenskqyeifk
    gslkpdashtcaidvdfnvgkiqkvkflwnksepklgasqitvqsgedgteynfcssdtv
    eenvlqslypc