PDB entry 2ox9

View 2ox9 on RCSB PDB site
Description: Mouse Scavenger Receptor C-type Lectin carbohydrate-recognition domain.
Class: sugar binding protein
Keywords: c-type lectin, SUGAR BINDING PROTEIN
Deposited on 2007-02-20, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Collectin placenta 1
    Species: Mus musculus [TaxId:10090]
    Gene: Colec12, CL-P1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox9a_
  • Chain 'B':
    Compound: Collectin placenta 1
    Species: Mus musculus [TaxId:10090]
    Gene: Colec12, CL-P1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox9b_
  • Chain 'C':
    Compound: Collectin placenta 1
    Species: Mus musculus [TaxId:10090]
    Gene: Colec12, CL-P1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox9c_
  • Chain 'D':
    Compound: Collectin placenta 1
    Species: Mus musculus [TaxId:10090]
    Gene: Colec12, CL-P1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ox9d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ox9A (A:)
    evngcpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgre
    shwigltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqc
    deinnficekereavpssil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox9A (A:)
    gcpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshw
    igltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqcdei
    nnficekere
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ox9B (B:)
    evngcpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgre
    shwigltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqc
    deinnficekereavpssil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox9B (B:)
    cpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshwi
    gltdseqesewkwldgspvdyknwkagqpdnwpgedcagliyagqwndfqcdeinnfice
    kereavp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ox9C (C:)
    evngcpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgre
    shwigltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqc
    deinnficekereavpssil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox9C (C:)
    cpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshwi
    gltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqcdein
    nficekereav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ox9D (D:)
    evngcpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgre
    shwigltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqc
    deinnficekereavpssil
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ox9D (D:)
    gcpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshw
    igltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqcdei
    nnficekere