PDB entry 2oww

View 2oww on RCSB PDB site
Description: Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose
Class: Transferase
Keywords: alpha-amylase, covalent intermediate, beta-alpha barrel, Transferase
Deposited on 2007-02-17, released 2007-04-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: malq
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72J82 (6-502)
      • modified residue (372)
    Domains in SCOPe 2.03: d2owwa_
  • Heterogens: ACR, G4D, MLI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2owwA (A:)
    gshmelprafglllhptslpgpygvgvlgqeardflrflkeaggrywqvlplgptgygds
    pyqsfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfke
    kaspeereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksa
    laeevafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldee
    grptvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrg
    feayweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfg
    lpgmkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmary
    ladwgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrl
    lpgelspehgarlramaeaterl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2owwA (A:)
    melprafglllhptslpgpygvgvlgqeardflrflkeaggrywqvlplgptgygdspyq
    sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
    peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
    evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
    tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrgfea
    yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
    mkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmarylad
    wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
    elspehgarlramaeaterl