PDB entry 2owp

View 2owp on RCSB PDB site
Description: Crystal structure of a cystatin-like fold protein (bxe_b1374) from burkholderia xenovorans lb400 at 2.00 A resolution
Class: unknown function
Keywords: Cystatin-like fold, duf3225 family protein, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2007-02-16, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein Bxe_B1374
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: YP_553940.1, Bxe_B1374, Bxeno_B1622
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13MU9 (1-128)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (31)
      • modified residue (103)
      • modified residue (127)
    Domains in SCOPe 2.08: d2owpa1, d2owpa2
  • Chain 'B':
    Compound: Hypothetical protein Bxe_B1374
    Species: BURKHOLDERIA XENOVORANS [TaxId:266265]
    Gene: YP_553940.1, Bxe_B1374, Bxeno_B1622
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13MU9 (1-128)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (31)
      • modified residue (103)
      • modified residue (127)
    Domains in SCOPe 2.08: d2owpb2, d2owpb3
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2owpA (A:)
    gmevnqpdivaqvqaafveyeralvendieamnalfwhtpetvrygiaevqhggeairaw
    rercepvpksrklhrtvvttfgtdfatvsteftsdatpllgrqmqtwarlspadgwkiva
    ahvsliamp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2owpB (B:)
    gmevnqpdivaqvqaafveyeralvendieamnalfwhtpetvrygiaevqhggeairaw
    rercepvpksrklhrtvvttfgtdfatvsteftsdatpllgrqmqtwarlspadgwkiva
    ahvsliamp