PDB entry 2owi

View 2owi on RCSB PDB site
Description: Solution structure of the RGS domain from human RGS18
Class: signaling protein
Keywords: signaling protein, structural genomics, structural genomics consortium, sgc
Deposited on 2007-02-16, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 18
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS18, RGS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NS28 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d2owia1, d2owia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2owiA (A:)
smvspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqih
lkakaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrf
lksdiyldlmegrpqrptnlrrrsrsftcne

    Sequence, based on observed residues (ATOM records): (download) 
    >2owiA (A:)
smvspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqih
lkakaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrf
lksdiyldlmegrp