PDB entry 2owh

View 2owh on RCSB PDB site
Description: Structure of an early-microsecond photolyzed state of CO-bjFixLH
Class: oxygen storage/transport
Keywords: PAS domain, oxygen sensor, heme, Laue diffraction
Deposited on 2007-02-16, released 2007-06-19
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-19, with a file datestamp of 2007-06-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sensor protein fixl
  Species: Bradyrhizobium japonicum
  Gene: fixL
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23222 (0-115)
  Domains in SCOP 1.73: d2owha1
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2owhA (A:)
  damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
  hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel