PDB entry 2owh

View 2owh on RCSB PDB site
Description: Structure of an early-microsecond photolyzed state of CO-bjFixLH
Class: oxygen storage/transport
Keywords: PAS domain, oxygen sensor, heme, Laue diffraction, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2007-02-16, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor protein fixl
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Gene: fixL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2owha_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2owhA (A:)
    damividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrttsdp
    hiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqel