PDB entry 2owc

View 2owc on RCSB PDB site
Description: Structure of a covalent intermediate in Thermus thermophilus amylomaltase
Class: transferase
Keywords: amylomaltase, alpha-amylase, beta-alpha-barrel, glycosyl-enzyme, TRANSFERASE
Deposited on 2007-02-16, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-alpha-glucanotransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: malq
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72J82 (3-501)
      • modified residue (372)
    Domains in SCOPe 2.06: d2owca_
  • Heterogens: ACR, MLI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2owcA (A:)
    gshmelprafglllhptslpgpygvgvlgqeardflrflkeaggrywqvlplgptgygds
    pyqsfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfke
    kaspeereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksa
    laeevafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldee
    grptvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrg
    feayweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfg
    lpgmkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmary
    ladwgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrl
    lpgelspehgarlramaeaterl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2owcA (A:)
    melprafglllhptslpgpygvgvlgqeardflrflkeaggrywqvlplgptgygdspyq
    sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
    peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
    evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
    tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrgfea
    yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
    mkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmarylad
    wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
    elspehgarlramaeaterl