PDB entry 2ow3

View 2ow3 on RCSB PDB site
Description: Glycogen synthase kinase-3 beta in complex with bis-(indole)maleimide pyridinophane inhibitor
Class: transferase
Keywords: Kinase-inhibitor complex, TRANSFERASE
Deposited on 2007-02-15, released 2008-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.248
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841 (0-End)
      • modified residue (181)
    Domains in SCOPe 2.06: d2ow3a_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841 (0-351)
      • modified residue (181)
    Domains in SCOPe 2.06: d2ow3b_
  • Heterogens: BIM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ow3A (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ow3A (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyskdevylnlvldyvpetvyrvarhysrakqtlpviyv
    klymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyic
    sryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptr
    eqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahs
    ffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ow3B (B:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqa