PDB entry 2ow1

View 2ow1 on RCSB PDB site
Description: MMP-9 active site mutant with trifluoromethyl hydroxamate inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: MATRIX METALLOPROTEINASE, S1-PRIME POCKET, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2007-02-15, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB)
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (0-105)
      • engineered (117)
    • Uniprot P14780 (106-158)
    Domains in SCOPe 2.08: d2ow1a_
  • Chain 'B':
    Compound: Matrix metalloproteinase-9 (MMP-9) (92 kDa type IV collagenase) (92 kDa gelatinase) (Gelatinase B) (GELB)
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP9, CLG4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14780 (Start-105)
      • engineered (117)
    • Uniprot P14780 (106-158)
    Domains in SCOPe 2.08: d2ow1b_
  • Heterogens: ZN, CA, CL, 7MR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ow1A (A:)
    fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
    fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
    halgldhssvpealmypmyrftegpplhkddvngirhly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ow1B (B:)
    fegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviq
    fgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfg
    halgldhssvpealmypmyrftegpplhkddvngirhly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ow1B (B:)
    lkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadiviqfgva
    ehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgqgyslflvaahqfghalg
    ldhssvpealmypmyrftegpplhkddvngirhly