PDB entry 2ovw

View 2ovw on RCSB PDB site
Description: endoglucanase I complexed with cellobiose
Class: hydrolase
Keywords: glycosyl hydrolase, endoglucanase I, complexed with cellobiose, glycosylated protein, hydrolase
Deposited on 1997-04-04, released 1998-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.209
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase I
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ovwa_
  • Chain 'B':
    Compound: endoglucanase I
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ovwb_
  • Chain 'C':
    Compound: endoglucanase I
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ovwc_
  • Chain 'D':
    Compound: endoglucanase I
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ovwd_
  • Heterogens: NAG, CBI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ovwA (A:)
    etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
    pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
    hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
    fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
    wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
    isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
    vagpcdategdpknivkvqpnpevtfsnirigeigstssvkapaypgphrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovwA (A:)
    etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
    pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
    hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
    fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
    wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
    isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
    vagpcdategdpknivkvqpnpevtfsnirigeigsts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ovwB (B:)
    etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
    pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
    hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
    fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
    wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
    isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
    vagpcdategdpknivkvqpnpevtfsnirigeigstssvkapaypgphrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovwB (B:)
    etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
    pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
    hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
    fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
    wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
    isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
    vagpcdategdpknivkvqpnpevtfsnirigeigsts
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ovwC (C:)
    etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
    pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
    hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
    fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
    wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
    isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
    vagpcdategdpknivkvqpnpevtfsnirigeigstssvkapaypgphrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovwC (C:)
    etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
    pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
    hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
    fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
    wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
    isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
    vagpcdategdpknivkvqpnpevtfsnirigeigsts
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ovwD (D:)
    etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
    pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
    hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
    fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
    wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
    isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
    vagpcdategdpknivkvqpnpevtfsnirigeigstssvkapaypgphrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovwD (D:)
    etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
    pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
    hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
    fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
    wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
    isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
    vagpcdategdpknivkvqpnpevtfsnirigeigsts