PDB entry 2ovo

View 2ovo on RCSB PDB site
Description: the crystal and molecular structure of the third domain of silver pheasant ovomucoid (omsvp3)
Class: proteinase inhibitor (kazal)
Keywords: proteinase inhibitor (kazal)
Deposited on 1985-06-11, released 1985-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ovomucoid third domain
    Species: Lophura nycthemera [TaxId:9046]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ovoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ovoA (A:)
    laavsvdcseypkpactmeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc