PDB entry 2ovl

View 2ovl on RCSB PDB site
Description: Crystal structure of a racemase from Streptomyces coelicolor A3(2)
Class: isomerase
Keywords: Crystal structure, racemase, Streptomyces coelicolor A3(2), 9301a, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ISOMERASE
Deposited on 2007-02-14, released 2007-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.215
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative racemase
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO3480, SCE65.16c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RKF7 (3-End)
      • cloning artifact (2)
      • modified residue (27-28)
      • modified residue (62)
      • modified residue (86)
      • modified residue (166)
      • modified residue (194)
      • modified residue (199)
      • modified residue (293)
      • modified residue (317)
      • modified residue (328)
      • modified residue (332)
    Domains in SCOPe 2.07: d2ovla1, d2ovla2, d2ovla3
  • Chain 'B':
    Compound: Putative racemase
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO3480, SCE65.16c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RKF7 (3-End)
      • cloning artifact (2)
      • modified residue (27-28)
      • modified residue (62)
      • modified residue (86)
      • modified residue (166)
      • modified residue (194)
      • modified residue (199)
      • modified residue (293)
      • modified residue (317)
      • modified residue (328)
      • modified residue (332)
    Domains in SCOPe 2.07: d2ovlb1, d2ovlb2, d2ovlb3
  • Chain 'C':
    Compound: Putative racemase
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO3480, SCE65.16c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RKF7 (3-End)
      • cloning artifact (2)
      • modified residue (27-28)
      • modified residue (62)
      • modified residue (86)
      • modified residue (166)
      • modified residue (194)
      • modified residue (199)
      • modified residue (293)
      • modified residue (317)
      • modified residue (328)
      • modified residue (332)
    Domains in SCOPe 2.07: d2ovlc1, d2ovlc2, d2ovlc3
  • Chain 'D':
    Compound: Putative racemase
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO3480, SCE65.16c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RKF7 (3-End)
      • cloning artifact (2)
      • modified residue (62)
      • modified residue (86)
      • modified residue (166)
      • modified residue (194)
      • modified residue (199)
      • modified residue (293)
      • modified residue (317)
      • modified residue (332)
    Domains in SCOPe 2.07: d2ovld1, d2ovld2, d2ovld3
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ovlA (A:)
    msliervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaav
    atmvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirar
    tplwklfggydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdr
    vsalrehlgdsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivre
    sghtiaggenlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshg
    vhdltvhalasvphrtymeahgfglhaymaepmavtdgcvsapdrpghgvvldferlgrl
    avgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovlA (A:)
    liervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavat
    mvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartp
    lwklfggydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvs
    alrehlgdsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresg
    htiaggenlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvh
    dltvhalasvphrtymeahlhaymaepmavtdgcvsapdrpghgvvldferlgrlav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ovlB (B:)
    msliervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaav
    atmvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirar
    tplwklfggydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdr
    vsalrehlgdsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivre
    sghtiaggenlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshg
    vhdltvhalasvphrtymeahgfglhaymaepmavtdgcvsapdrpghgvvldferlgrl
    avgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovlB (B:)
    liervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavat
    mvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartp
    lwklfggydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvs
    alrehlgdsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresg
    htiaggenlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvh
    dltvhalasvphrtymeahlhaymaepmavtdgcvsapdrpghgvvldferlgrlav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ovlC (C:)
    msliervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaav
    atmvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirar
    tplwklfggydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdr
    vsalrehlgdsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivre
    sghtiaggenlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshg
    vhdltvhalasvphrtymeahgfglhaymaepmavtdgcvsapdrpghgvvldferlgrl
    avgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovlC (C:)
    liervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaavat
    mvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartp
    lwklfggydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvs
    alrehlgdsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresg
    htiaggenlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvh
    dltvhalasvphrtymeahlhaymaepmavtdgcvsapdrpghgvvldferlgrlav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ovlD (D:)
    msliervrtdlyriplptrltdsthgammdfelitvriedsdgatglgytytvnhggaav
    atmvdkdlrgcllgadaeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirar
    tplwklfggydpvvpvyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdr
    vsalrehlgdsfplmvdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivre
    sghtiaggenlhtlydfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshg
    vhdltvhalasvphrtymeahgfglhaymaepmavtdgcvsapdrpghgvvldferlgrl
    avgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ovlD (D:)
    liervrtdlyripldfelitvriedsdgatglgytytvnhggaavatmvdkdlrgcllga
    daeqiekiwqsmwwrlhyagrgghatsaisavdialwdlkgirartplwklfggydpvvp
    vyaggidlelpvadlktqadrflaggfraikmkvgrpdlkedvdrvsalrehlgdsfplm
    vdanmkwtvdgairaaralapfdlhwieeptipddlvgnarivresghtiaggenlhtly
    dfhnavragsltlpepdvsniggyttfrkvaalaeannmlltshgvhdltvhalasvphr
    tymeahmavtdgcvsapdrpghgvvldferlgrl