PDB entry 2ovg

View 2ovg on RCSB PDB site
Description: Lambda Cro Q27P/A29S/K32Q triple mutant at 1.35 A in space group P3221
Class: transcription
Keywords: Transcription factor, helix-turn-helix, bacteriophage, flexibility, TRANSCRIPTION
Deposited on 2007-02-13, released 2008-01-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.134
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phage lambda Cro
  Species: Enterobacteria phage lambda [TaxId:10710]
  Gene: cro
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03040
    • engineered (26)
    • engineered (28)
    • engineered (31)
  Domains in SCOPe 2.05: d2ovga_
• Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ovgA (A:)
  meqritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps
  nkktta
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ovgA (A:)
  qritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps