PDB entry 2ov9

View 2ov9 on RCSB PDB site
Description: Crystal structure of protein RHA08564, thioesterase superfamily protein
Class: hydrolase
Keywords: Rhodococcus sp. RHA1, RHA08564, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, HYDROLASE
Deposited on 2007-02-13, released 2007-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA1_ro05818
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S4E1
      • modified residue (78)
      • modified residue (153)
      • modified residue (178)
    Domains in SCOPe 2.07: d2ov9a1
  • Chain 'B':
    Compound: hypothetical protein
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA1_ro05818
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S4E1
      • modified residue (78)
      • modified residue (153)
      • modified residue (178)
    Domains in SCOPe 2.07: d2ov9b_
  • Chain 'C':
    Compound: hypothetical protein
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA1_ro05818
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S4E1
      • modified residue (78)
      • modified residue (153)
      • modified residue (178)
    Domains in SCOPe 2.07: d2ov9c_
  • Chain 'D':
    Compound: hypothetical protein
    Species: Rhodococcus sp. [TaxId:101510]
    Gene: RHA1_ro05818
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0S4E1
      • modified residue (78)
      • modified residue (153)
      • modified residue (178)
    Domains in SCOPe 2.07: d2ov9d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ov9A (A:)
    vsvgthptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelns
    iaghleehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtlti
    pyqgppghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklms
    vdgrkittagdirtadgqvcvsveglfvdktvprpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov9A (A:)
    ptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghle
    ehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgpp
    ghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrki
    ttagdirtadgqvcvsveglfvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ov9B (B:)
    vsvgthptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelns
    iaghleehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtlti
    pyqgppghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklms
    vdgrkittagdirtadgqvcvsveglfvdktvprpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov9B (B:)
    thptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiagh
    leehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqg
    ppghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgr
    kittagdirtadgqvcvsveglfvd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ov9C (C:)
    vsvgthptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelns
    iaghleehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtlti
    pyqgppghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklms
    vdgrkittagdirtadgqvcvsveglfvdktvprpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov9C (C:)
    hptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghl
    eehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgp
    pghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrk
    ittagdirtadgqvcvsveglfvdkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ov9D (D:)
    vsvgthptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelns
    iaghleehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtlti
    pyqgppghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklms
    vdgrkittagdirtadgqvcvsveglfvdktvprpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ov9D (D:)
    gtvltsppgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghleehapavaer
    lidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgppghvhggvsa
    llldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrkittagdirta
    dgqvcvsveglfv