PDB entry 2ouw

View 2ouw on RCSB PDB site
Description: Crystal structure of Alkylhydroperoxidase AhpD core (YP_425393.1) from Rhodospirillum rubrum ATCC 11170 at 1.95 A resolution
Class: oxidoreductase
Keywords: YP_425393.1, Carboxymuconolactone decarboxylase family, Alkylhydroperoxidase AhpD core, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, OXIDOREDUCTASE
Deposited on 2007-02-12, released 2007-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkylhydroperoxidase AhpD core
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: YP_425393.1, Rru_A0301
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RXN9 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (59)
      • modified residue (72)
      • modified residue (99)
      • modified residue (124)
    Domains in SCOPe 2.07: d2ouwa1, d2ouwa2
  • Chain 'B':
    Compound: Alkylhydroperoxidase AhpD core
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: YP_425393.1, Rru_A0301
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2RXN9 (1-End)
      • leader sequence (0)
      • modified residue (1)
      • modified residue (59)
      • modified residue (72)
      • modified residue (99)
      • modified residue (124)
    Domains in SCOPe 2.07: d2ouwb2, d2ouwb3
  • Heterogens: NA, UNL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ouwA (A:)
    gmatvrllddaeistlpevkavfddiratrgsdfvnniwrglandpallkrtweqvktvm
    vgegaldpltremiylavstanscsycahshtaaarakgmtpaqhaevlaiiglaaqtna
    lvtamqipvdeaflvdgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ouwA (A:)
    gmatvrllddaeistlpevkavfddiratrgsdfvnniwrglandpallkrtweqvktvm
    vgegaldpltremiylavstanscsycahshtaaarakgmtpaqhaevlaiiglaaqtna
    lvtamqipvdeaflv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ouwB (B:)
    gmatvrllddaeistlpevkavfddiratrgsdfvnniwrglandpallkrtweqvktvm
    vgegaldpltremiylavstanscsycahshtaaarakgmtpaqhaevlaiiglaaqtna
    lvtamqipvdeaflvdgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ouwB (B:)
    gmatvrllddaeistlpevkavfddiratrgsdfvnniwrglandpallkrtweqvktvm
    vgegaldpltremiylavstanscsycahshtaaarakgmtpaqhaevlaiiglaaqtna
    lvtamqipvdeaflvd