PDB entry 2out

View 2out on RCSB PDB site
Description: Solution Structure of HI1506, a Novel Two Domain Protein from Haemophilus influenzae
Class: structural genomics, unknown function
Keywords: structural genomics, NMR, Haemophilus influenzae, hypothetical protein, Structure 2 Function Project, S2F, UNKNOWN FUNCTION
Deposited on 2007-02-12, released 2007-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mu-like prophage FluMu protein gp35, Protein HI1507 in Mu-like prophage FluMu region
  Species: Haemophilus influenzae [TaxId:727]
  Gene: HI1506, HI1507
  Database cross-references and differences (RAF-indexed):
  • Uniprot P44229 (94-130)
    • cloning artifact (0-2)
    • see remark 999 (70-93)
  Domains in SCOPe 2.08: d2outa1, d2outa2, d2outa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2outA (A:)
  gshmdktfcvvvqnrikegyrragfsfhlgdnslaavsesqlaqlkadprlvvqitetgs
  qeggeglskepagsdeqkqlradppstdlntftveqlkaqltergitfkqsatkaelial
  fapadgeksea