PDB entry 2ouo

View 2ouo on RCSB PDB site
Description: Crystal Structure of the Bromo domain 2 in human Bromodomain Containing Protein 4 (BRD4)
Class: signaling protein
Keywords: BRD4, bromodomain containing protein 4, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2007-02-12, released 2007-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ouoa_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ouoA (A:)
    smkdvpdsqqhpapeksskvseqlkccsgilkemfakkhaayawpfykpvdvealglhdy
    cdiikhpmdmstikskleareyrdaqefgadvrlmfsncykynppdhevvamarklqdvf
    emrfakmpde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ouoA (A:)
    kvseqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskle
    areyrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakmpd