PDB entry 2oul

View 2oul on RCSB PDB site
Description: The Structure of Chagasin in Complex with a Cysteine Protease Clarifies the Binding Mode and Evolution of a New Inhibitor Family
Class: HYDROLASE/hydrolase inhibitor
Keywords: cysteine protease, inhibitor, macromolecular interaction, HYDROLASE-hydrolase inhibitor COMPLEX
Deposited on 2007-02-11, released 2008-02-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: falcipain 2
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: AAF97809
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2oula_
  • Chain 'B':
    Compound: Chagasin
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene: cha
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2oulb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oulA (A:)
    qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
    klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
    ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
    fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2oulB (B:)
    mshkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfpp
    dskllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oulB (B:)
    kvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppdsk
    llgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan