PDB entry 2ouj

View 2ouj on RCSB PDB site
Description: The crystal structure of the Thrombospondin-1 N-terminal domain in complex with fractionated Heparin DP8
Class: cell adhesion
Keywords: TSP-1, TSPN-1, HBD, Fractionated Heparin, DP8, CELL ADHESION
Deposited on 2007-02-11, released 2008-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.253
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombospondin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: THBS1, TSP, TSP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ouja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oujA (A:)
    rspwnripesggdnsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddk
    fqdlvdavrtekgflllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltv
    qgkqhvvsveeallatgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasi
    arlriakggvndnfqgvlqnvrfvfgttpedilrnkgcssstsvlltldnnvvngsspai
    rtntghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oujA (A:)
    svfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrtekgf
    lllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsveeall
    atgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggvndnf
    qgvlqnvrfvfgttpedilrnkgc