PDB entry 2ou6

View 2ou6 on RCSB PDB site
Description: Crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 A resolution
Class: metal binding protein
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, metal binding protein
Deposited on 2007-02-09, released 2007-02-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.157
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: NP_294789.1, DR_1065
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RVG4
      • modified residue (39)
      • modified residue (108)
      • modified residue (166)
    Domains in SCOPe 2.01: d2ou6a1
  • Heterogens: NI, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ou6A (A:)
    gmptfnpelhaqtlnserayfvqpdadpaftphigalvemltyarlttlqaveglpedql
    watapgfansigtllahiaavervyhvlsfqgrdvtpeddgaaywgltmgkegtaparlp
    tldelraeladaraetlrvfaakddawlaeplgpgwanqhwawfhvmedevnhrgqlrll
    rqvlapeegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou6A (A:)
    ptfnpelhaqtlnserayfvqpdadpaftphigalvemltyarlttlqaveglpedqlwa
    tapgfansigtllahiaavervyhvlsfqgrdvtpeddgaaywgltmgkegtaparlptl
    delraeladaraetlrvfaakddawlaeplgpgwanqhwawfhvmedevnhrgqlrllrq
    vla