PDB entry 2ou1

View 2ou1 on RCSB PDB site
Description: Structures of apolipoprotein A-II and a lipid surrogate complex provide insights into apolipoprotein-lipid interactions
Class: lipid binding protein
Keywords: apolipoprotein, high density lipoproteins, helix, apolipoprotein a-II, cholesterol metabolism x-ray diffraction, lipid binding protein
Deposited on 2007-02-09, released 2007-03-06
Made obsolete on 2018-05-09

The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1a_
  • Chain 'B':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1b_
  • Chain 'C':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1c_
  • Chain 'D':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1d_
  • Chain 'E':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1e_
  • Chain 'F':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1f_
  • Chain 'G':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1g_
  • Chain 'H':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1h_
  • Chain 'I':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1i_
  • Chain 'J':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1j_
  • Chain 'K':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1k_
  • Chain 'L':
    Compound: Apolipoprotein A-II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ou1l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ou1A (A:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1A (A:)
    epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnl
    syfvelgtqpat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ou1B (B:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1B (B:)
    epcvslvsqyqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnfls
    yfvelgtqpat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ou1C (C:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1C (C:)
    epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnf
    lsyfvelgtqpat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ou1D (D:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1D (D:)
    epceslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnfl
    syfvelgtqpat
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ou1E (E:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1E (E:)
    epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnl
    syfvelgtqpat
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ou1F (F:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1F (F:)
    epcvslvsqyqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnfls
    yfvelgtqpat
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ou1G (G:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1G (G:)
    epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnf
    lsyfvelgtqpat
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ou1H (H:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1H (H:)
    epceslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnfl
    syfvelgtqpat
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ou1I (I:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1I (I:)
    epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnl
    syfvelgtqpat
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ou1J (J:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1J (J:)
    epcslvsqyqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnflsy
    fvelgtqpat
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ou1K (K:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1K (K:)
    epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnf
    lsyfvelgtqpat
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ou1L (L:)
    qakepcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtel
    vnflsyfvelgtqpatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ou1L (L:)
    epceslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnfl
    syfvelgtqpat