PDB entry 2otx

View 2otx on RCSB PDB site
Description: Crystal Structure of A N-terminal Fragment of SKAP-HOM Containing both the Helical Dimerization Domain and the PH Domain
Class: signaling protein
Keywords: novel dimerization domain, ph domain, signaling protein
Deposited on 2007-02-09, released 2007-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Src kinase-associated phosphoprotein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Skap2, Prap, Ra70, Saps, Scap2, Skap55r
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3UND0 (0-210)
      • engineered (0-1)
    Domains in SCOPe 2.06: d2otxa_
  • Chain 'B':
    Compound: Src kinase-associated phosphoprotein 2
    Species: Mus musculus [TaxId:10090]
    Gene: Skap2, Prap, Ra70, Saps, Scap2, Skap55r
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2otxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2otxA (A:)
    gspeeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaed
    gdeyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhs
    flgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeica
    pdkriyqftaaspkdaeewvqqlkfilqdlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otxA (A:)
    gspeeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaq
    dlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvr
    mnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2otxB (B:)
    gspeeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaed
    gdeyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhs
    flgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeica
    pdkriyqftaaspkdaeewvqqlkfilqdlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otxB (B:)
    peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaqdl
    pfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmn
    ntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg