PDB entry 2otp

View 2otp on RCSB PDB site
Description: Crystal Structure of Immunoglobulin-Like Transcript 1 (ILT1/LIR7/LILRA2)
Class: immune system
Keywords: ILT1, activating receptor, dimer, monomer, domain swapping, IMMUNE SYSTEM
Deposited on 2007-02-08, released 2008-02-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.176
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukocyte immunoglobulin-like receptor subfamily A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LILRA2, ILT1, LIR7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N149 (Start-195)
      • engineered (141)
    Domains in SCOPe 2.04: d2otpa1, d2otpa2
  • Chain 'B':
    Compound: Leukocyte immunoglobulin-like receptor subfamily A member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: LILRA2, ILT1, LIR7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8N149 (Start-195)
      • engineered (141)
    Domains in SCOPe 2.04: d2otpb1, d2otpb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2otpA (A:)
    ghlpkptlwaepgsviiqgspvtlrcqgslqaeeyhlyrenksaswvrriqepgkngqfp
    ipsitwehagryhcqyyshnhsseysdplelvvtgayskptlsalpspvvtlggnvtlqc
    vsqvafdgfilckegedehpqclnshshargwswaifsvgpvspsrrwsyrcyaydsnsp
    yvwslpsdllellvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otpA (A:)
    lpkptlwaepgsviiqgspvtlrcqgslqaeeyhlyrenkaswvrriqepgkngqfpips
    itwehagryhcqyyshnhsseysdplelvvtgayskptlsalpspvvtlggnvtlqcvsq
    vafdgfilckegedehpqclnshshargwswaifsvgpvspsrrwsyrcyaydsnspyvw
    slpsdllellvpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2otpB (B:)
    ghlpkptlwaepgsviiqgspvtlrcqgslqaeeyhlyrenksaswvrriqepgkngqfp
    ipsitwehagryhcqyyshnhsseysdplelvvtgayskptlsalpspvvtlggnvtlqc
    vsqvafdgfilckegedehpqclnshshargwswaifsvgpvspsrrwsyrcyaydsnsp
    yvwslpsdllellvpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otpB (B:)
    lpkptlwaepgsviiqgspvtlrcqgslqaeeyhlyrenksaswvrriqepgkngqfpip
    sitwehagryhcqyyshnhsseysdplelvvtgayskptlsalpspvvtlggnvtlqcvs
    qvafdgfilckegedehpqclnshshargwswaifsvgpvspsrrwsyrcyaydsnspyv
    wslpsdllellvpg