PDB entry 2otk

View 2otk on RCSB PDB site
Description: Structure of Alzheimer Ab peptide in complex with an engineered binding protein
Class: de novo protein, peptide binding protein
Keywords: protein-peptide complex, beta-hairpin, intermolecular beta-sheet, DE NOVO PROTEIN, PEPTIDE BINDING PROTEIN
Deposited on 2007-02-08, released 2008-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: amyloid beta a4 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: ZAb3 Affibody dimer
    Species: engineered binding protein
    Database cross-references and differences (RAF-indexed):
    • PDB 2OTK
    Domains in SCOPe 2.08: d2otke_
  • Chain 'F':
    Compound: ZAb3 Affibody dimer
    Species: engineered binding protein
    Database cross-references and differences (RAF-indexed):
    • PDB 2OTK
    Domains in SCOPe 2.08: d2otkf_

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2otkE (E:)
    gsshhhhhhlqvdnkfnkemasaggeivylpnlnpdqlcafihslhddpsqsanllaeak
    klndaqapkvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otkE (E:)
    geivylpnlnpdqlcafihslhddpsqsanllaeakklndaqa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2otkF (F:)
    gsshhhhhhlqvdnkfnkemasaggeivylpnlnpdqlcafihslhddpsqsanllaeak
    klndaqapkvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2otkF (F:)
    geivylpnlnpdqlcafihslhddpsqsanllaeakklndaqa