PDB entry 2oth

View 2oth on RCSB PDB site
Description: Crystal structure of a ternary complex of phospholipase A2 with indomethacin and nimesulide at 2.9 A resolution
Class: hydrolase
Keywords: Complex, Inhibitor, Hydrolase
Deposited on 2007-02-08, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 VRV-PL-VIIIa
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2otha_
  • Heterogens: NIM, IMN, CCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2othA (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c