PDB entry 2otb

View 2otb on RCSB PDB site
Description: Crystal structure of a monomeric cyan fluorescent protein in the fluorescent state
Class: fluorescent protein
Keywords: Beta can, Fluorescent protein
Deposited on 2007-02-07, released 2007-04-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like fluorescent chromoprotein cFP484
    Species: Clavularia sp. [TaxId:86521]
    Gene: cFP484
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y3 (0-213)
      • engineered mutation (36)
      • engineered mutation (38)
      • engineered mutation (56)
      • chromophore (60)
      • engineered mutation (64)
      • engineered mutation (72-73)
      • engineered mutation (115-117)
      • engineered mutation (119)
      • engineered mutation (142)
      • engineered mutation (154)
      • engineered mutation (156)
      • engineered mutation (165)
      • engineered mutation (167)
      • engineered mutation (171)
      • engineered mutation (174)
      • engineered mutation (178)
      • engineered mutation (205)
      • engineered mutation (208)
    Domains in SCOPe 2.03: d2otba_
  • Chain 'B':
    Compound: GFP-like fluorescent chromoprotein cFP484
    Species: Clavularia sp. [TaxId:86521]
    Gene: cFP484
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y3 (0-213)
      • engineered mutation (36)
      • engineered mutation (38)
      • engineered mutation (56)
      • chromophore (60)
      • engineered mutation (64)
      • engineered mutation (72-73)
      • engineered mutation (115-117)
      • engineered mutation (119)
      • engineered mutation (142)
      • engineered mutation (154)
      • engineered mutation (156)
      • engineered mutation (165)
      • engineered mutation (167)
      • engineered mutation (171)
      • engineered mutation (174)
      • engineered mutation (178)
      • engineered mutation (205)
      • engineered mutation (208)
    Domains in SCOPe 2.03: d2otbb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2otbA (A:)
    gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydiltnaf
    xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge
    nfppngpvmqkktlkwepsteilyvrdgvlvgdikhkllleggghhrvdfktiyrakkav
    klpdyhfvdhrieilnhdkdynkvtvyesavary
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2otbB (B:)
    gvikpdmkiklkmegnvnghafviegegegkpydgtntinlevkegaplpfsydiltnaf
    xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdismeedsfiyeihlkge
    nfppngpvmqkktlkwepsteilyvrdgvlvgdikhkllleggghhrvdfktiyrakkav
    klpdyhfvdhrieilnhdkdynkvtvyesavary