PDB entry 2ota

View 2ota on RCSB PDB site
Description: Crystal structure of the UPF0352 protein CPS_2611 from Colwellia psychrerythraea. NESG target CsR4.
Class: structural genomics, unknown function
Keywords: NESG, Y2611_COLP3, UPF0352, CPS_2611, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2007-02-07, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0352 protein CPS_2611
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_2611
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q481E4 (Start-67)
      • modified residue (34)
      • expression tag (68-72)
    Domains in SCOPe 2.08: d2otaa1, d2otaa2
  • Chain 'B':
    Compound: UPF0352 protein CPS_2611
    Species: Colwellia psychrerythraea [TaxId:167879]
    Gene: CPS_2611
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q481E4 (Start-67)
      • modified residue (34)
      • expression tag (68)
    Domains in SCOPe 2.08: d2otab2, d2otab3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2otaA (A:)
mpivskysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnf
tkalkqsvlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2otaA (A:)
ysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnftkalkq
svlehhh

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2otaB (B:)
mpivskysnervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnf
tkalkqsvlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2otaB (B:)
nervekiiqdlldvlvkeevtpdlalmclgnavtniiaqvpeskrvavvdnftkalkqsv
l