PDB entry 2ot9

View 2ot9 on RCSB PDB site
Description: Crystal structure of YaeQ protein from Pseudomonas syringae
Class: structural genomics, unknown function
Keywords: YaeQ protein, Pseudomonas syringae, PSI-2, Protein Structure Initiative, MCSG, Structural Genomics, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2007-02-07, released 2007-03-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.18
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pseudomonas syringae pv. tomato [TaxId:223283]
    Gene: PSPTO_1487
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q886T9 (Start-179)
      • modified residue (39)
      • modified residue (143)
      • modified residue (152)
    Domains in SCOPe 2.05: d2ot9a1
  • Heterogens: NA, SRT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ot9A (A:)
maqpsttykfelnltdldrgvyesvkqtiarhpseteermtvrllayafwyneqlafgrg
lsdvdepalwekslddrvlhwievgqpdadrltwcsrrtertsllaygslrvwegkvipa
iknlknvniaavpqdvlevlakdmprvikwdvmisegtvfvtddrgqhevqlqwltgerg

    Sequence, based on observed residues (ATOM records): (download) 
    >2ot9A (A:)
aqpsttykfelnltdldrgvyesvkqtiarhpseteermtvrllayafwyneqlafgrgl
sdvdepalwekslddrvlhwievgqpdadrltwcsrrtertsllaygslrvwegkvipai
knlknvniaavpqdvlevlakdmprvikwdvmisegtvfvtddrgqhevqlqwltgerg