PDB entry 2ot1

View 2ot1 on RCSB PDB site
Description: Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with naphthol AS-E phosphate, a competitive inhibitor
Class: lyase
Keywords: glycolysis, competitive inhibition, hydrophobic pocket, LYASE
Deposited on 2007-02-07, released 2007-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.149
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ot1a_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ot1b_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ot1c_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ot1d_
  • Heterogens: N3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ot1A (A:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot1A (A:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsnhay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ot1B (B:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot1B (B:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpssnhay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ot1C (C:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot1C (C:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgsnhay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ot1D (D:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot1D (D:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsnhay