PDB entry 2ot0

View 2ot0 on RCSB PDB site
Description: Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a C-terminal peptide of Wiskott-Aldrich syndrome protein
Class: lyase
Keywords: complex, glycolysis, actin dynamics, hydrophobic pocket, WASp, LYASE
Deposited on 2007-02-07, released 2007-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.152
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ot0a_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ot0b_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ot0c_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase A
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: ALDOA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ot0d_
  • Chain 'E':
    Compound: Wiskott-Aldrich syndrome protein C-terminal peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Wiskott-Aldrich syndrome protein C-terminal peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Wiskott-Aldrich syndrome protein C-terminal peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Wiskott-Aldrich syndrome protein C-terminal peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ot0A (A:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot0A (A:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgeslfisnhay
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ot0B (B:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot0B (B:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqaslfisnhay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ot0C (C:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot0C (C:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsnhay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ot0D (D:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ot0D (D:)
    phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsnhay
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.