PDB entry 2osn

View 2osn on RCSB PDB site
Description: An alternate description of a crystal structure of phospholipase A2 from Bungarus caeruleus
Class: toxin
Keywords: phospholipase, krait venom, structure reinterpretation, TOXIN
Deposited on 2007-02-06, released 2007-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2osna_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2osnA (A:)
    nlqqfknmiqcagtrtwtayinygcycgkggsgtpvdkldrccythdhcynqadsipgcn
    pniktysytctqpnitctrtadacakflcdcdrtaaicfasapyninnimisasnscq