PDB entry 2osh

View 2osh on RCSB PDB site
Description: crystal structure of Natratoxin, a snake sPLA2 that blocks A-type K+ channel
Class: hydrolase
Keywords: Naja atra venom, PHOSPHOLIPASE A2, A-type K+ channel inhibitor, HYDROLASE
Deposited on 2007-02-06, released 2007-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 1
  Species: Naja atra [TaxId:8656]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00598 (0-118)
  Domains in SCOPe 2.08: d2osha_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2oshA (A:)
  nlyqfknmiqctvpsrswcdfadygcycgkggsgtpvddldrccqvhdncyneaekisgc
  wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapytdanynidlkarcq