PDB entry 2osc

View 2osc on RCSB PDB site
Description: Synthesis, Structural Analysis, and SAR Studies of Triazine Derivatives as Potent, Selective Tie-2 Inhibitors
Class: Transferase
Keywords: Kinase domain Tie-2, Transferase
Deposited on 2007-02-05, released 2007-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.251
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiopoietin-1 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: TEK, TIE2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2osca_
  • Heterogens: MUH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oscA (A:)
    knnpdptiypvldwndikfqdvigegnfgqvlkarikkdglrmdaaikrmkeyaskddhr
    dfagelevlcklghhpniinllgacehrgylylaieyaphgnlldflrksrvletdpafa
    ianstastlssqqllhfaadvargmdylsqkqfihrdlaarnilvgenyvakiadfglsr
    gqevyvkktmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpycgmtcael
    yeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerktyvnttl
    yekftyagidcsaeeaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oscA (A:)
    qvlkarimdaaikrmkkddhrdfagelevlcklghhpniinllgacehylaieyaphgnl
    ldflrksrvletdpafaianstastlssqqllhfaadvargmdylsqkqfihrdlaarni
    lvgenyvakiadfglmgrlpvrwmaieslnysvyttnsdvwsygvllweivslggtpycg
    mtcaelyeklpqgyrlekplncddevydlmrqcwrekpyerpsfaqilvslnrmleerkt
    yvnttlyekftyagi