PDB entry 2os7

View 2os7 on RCSB PDB site
Description: Caf1M periplasmic chaperone tetramer
Class: chaperone
Keywords: Immunoglobulin fold, Hetero beta barrel, CHAPERONE
Deposited on 2007-02-05, released 2007-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.252
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2os7a1, d2os7a2
  • Chain 'B':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2os7b1, d2os7b2
  • Chain 'C':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2os7c1, d2os7c2
  • Chain 'D':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2os7d1, d2os7d2
  • Chain 'E':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2os7e1, d2os7e2
  • Chain 'F':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Gene: caf1M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2os7f1, d2os7f2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2os7A (A:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2os7A (A:)
    pdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfv
    vtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkvgvfvqfainncikllv
    rpnelkgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwaf
    dlpkgnvswriindqggldrlysknv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2os7B (B:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2os7B (B:)
    kfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriypfvvtpplfrldakqq
    nslriaqaggvfprdkeslkwlcvkgipqkfnpdkdvgvfvqfainncikllvrpnelkg
    tpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlnvswr
    iindqggldrlysknv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2os7C (C:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2os7C (C:)
    pdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfv
    vtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgipvgvfvqfainncikllvrp
    nelkgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdl
    pgarnvswriindqggldrlysknv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2os7D (D:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2os7D (D:)
    kfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriypfvvtpplfrldakqq
    nslriaqaggvfprdkeslkwlcvkgipqkfnpdkdvgvfvqfainncikllvrpnelkg
    tpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlnvswr
    iindqggldrlyskn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2os7E (E:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2os7E (E:)
    pdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfv
    vtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgipvgvfvqfainncikllvrp
    nelkgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdl
    prnvswriindqggldrlyskn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2os7F (F:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2os7F (F:)
    kfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriypfvvtpplfrldakqq
    nslriaprdkeslkwlcvkgipqkfnpdkdvgvfvqfainncikllvrpnelkgtpiqfa
    enlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlnvswriindqg
    gldrlysknv