PDB entry 2orl

View 2orl on RCSB PDB site
Description: Solution structure of the cytochrome c- para-aminophenol adduct
Class: electron transport
Keywords: protein-ligand adduct
Deposited on 2007-02-03, released 2007-04-24
The last revision prior to the SCOP 1.75 freeze date was dated 2007-07-17, with a file datestamp of 2007-07-20.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c iso-1
  Species: Saccharomyces cerevisiae
  Gene: CYC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-106)
    • engineered (105)
  Domains in SCOP 1.75: d2orla1
• Heterogens: HEC, 4NL

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2orlA (A:)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate