PDB entry 2orl

View 2orl on RCSB PDB site
Description: Solution structure of the cytochrome c- para-aminophenol adduct
Class: electron transport
Keywords: protein-ligand adduct, ELECTRON TRANSPORT
Deposited on 2007-02-03, released 2007-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • engineered (106)
    Domains in SCOPe 2.08: d2orla_
  • Heterogens: HEC, 4NL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2orlA (A:)
    tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate