PDB entry 2ord

View 2ord on RCSB PDB site
Description: Crystal structure of Acetylornithine aminotransferase (EC 2.6.1.11) (ACOAT) (TM1785) from Thermotoga maritima at 1.40 A resolution
Class: transferase
Keywords: TM1785, Acetylornithine aminotransferase (EC 2.6.1.11) (ACOAT), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, TRANSFERASE
Deposited on 2007-02-02, released 2007-02-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.149
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine aminotransferase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: argD, TM1785
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X2A5 (12-396)
      • leader sequence (4-11)
      • modified residue (12)
      • modified residue (15)
      • modified residue (84)
      • modified residue (179)
      • modified residue (228)
      • modified residue (314)
      • modified residue (320)
      • modified residue (333)
      • modified residue (336)
    Domains in SCOPe 2.05: d2orda_
  • Chain 'B':
    Compound: Acetylornithine aminotransferase
    Species: Thermotoga maritima [TaxId:243274]
    Gene: argD, TM1785
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X2A5 (12-396)
      • leader sequence (4-11)
      • modified residue (12)
      • modified residue (15)
      • modified residue (84)
      • modified residue (179)
      • modified residue (228)
      • modified residue (314)
      • modified residue (320)
      • modified residue (333)
      • modified residue (336)
    Domains in SCOPe 2.05: d2ordb_
  • Heterogens: PLP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ordA (A:)
    mgsdkihhhhhhmylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshpr
    lveaikdqaeklihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarky
    gkkksekkyrilsahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkm
    sedvcavflepiqgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqk
    ygvvpdvlttakglgggvpigavivneranvlepgdhgttfggnplacragvtvikeltk
    egfleeveekgnylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkl
    lvvpagnntirflppltveygeidlavetlkkvlqgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ordA (A:)
    kihhhhhhmylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshprlvea
    ikdqaeklihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarkygkkk
    sekkyrilsahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkmsedv
    cavflepiqgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqkygvv
    pdvlttakglgggvpigavivneranvlepgdhgttfggnplacragvtvikeltkegfl
    eeveekgnylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkllvvp
    agnntirflppltveygeidlavetlkkvlqgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ordB (B:)
    mgsdkihhhhhhmylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshpr
    lveaikdqaeklihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarky
    gkkksekkyrilsahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkm
    sedvcavflepiqgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqk
    ygvvpdvlttakglgggvpigavivneranvlepgdhgttfggnplacragvtvikeltk
    egfleeveekgnylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkl
    lvvpagnntirflppltveygeidlavetlkkvlqgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ordB (B:)
    kihhhhhhmylmntysrfpatfvygkgswiydekgnayldftsgiavnvlghshprlvea
    ikdqaeklihcsnlfwnrpqmelaellskntfggkvffantgteaneaaikiarkygkkk
    sekkyrilsahnsfhgrtlgsltatgqpkyqkpfeplvpgfeyfefnnvedlrrkmsedv
    cavflepiqgesgivpatkefleearklcdeydallvfdevqcgmgrtgklfayqkygvv
    pdvlttakglgggvpigavivneranvlepgdhgttfggnplacragvtvikeltkegfl
    eeveekgnylmkklqemkeeydvvadvrgmglmigiqfreevsnrevatkcfenkllvvp
    agnntirflppltveygeidlavetlkkvlqgi