PDB entry 2orc

View 2orc on RCSB PDB site
Description: cro repressor insertion mutant k56-[dgevk], nmr, 32 structures
Deposited on 1998-01-20, released 1998-05-27
The last revision prior to the SCOP 1.71 freeze date was dated 1998-05-27, with a file datestamp of 1998-05-27.
Experiment type: NMR32
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d2orc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2orc_ (-)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkdgev
    kpfpsnkktta