PDB entry 2orb

View 2orb on RCSB PDB site
Description: The structure of the anti-c-myc antibody 9E10 Fab fragment
Class: immune system
Keywords: ANTIGEN-ANTIBODY COMPLEX, ANTIGEN RECOGNITION, long CDR H3, IMMUNE SYSTEM
Deposited on 2007-02-02, released 2008-02-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.261
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Monoclonal anti-c-myc antibody 9E10
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ORB (0-227)
    Domains in SCOPe 2.04: d2orbh1
  • Chain 'I':
    Compound: Monoclonal anti-c-myc antibody 9E10
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ORB (0-227)
    Domains in SCOPe 2.04: d2orbi1
  • Chain 'L':
    Compound: Monoclonal anti-c-myc antibody 9E10
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ORB (0-End)
    Domains in SCOPe 2.04: d2orbl1, d2orbl2
  • Chain 'M':
    Compound: Monoclonal anti-c-myc antibody 9E10
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ORB (0-End)
    Domains in SCOPe 2.04: d2orbm1, d2orbm2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2orbH (H:)
    evhlvesggdlvkpggslklscaasgftfshygmswvrqtpdkrlewvatigsrgtythy
    pdsvkgrftisrdndknalylqmnslksedtamyycarrsefyyygntyyysamdywgqg
    asvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtf
    pavlqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2orbH (H:)
    evhlvesggdlvkpggslklscaasgftfshygmswvrqtpdkrlewvatigsrgtythy
    pdsvkgrftisrdndknalylqmnslksedtamyycarrseysamdywgqgasvtvssak
    ttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvt
    vpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2orbI (I:)
    evhlvesggdlvkpggslklscaasgftfshygmswvrqtpdkrlewvatigsrgtythy
    pdsvkgrftisrdndknalylqmnslksedtamyycarrsefyyygntyyysamdywgqg
    asvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtf
    pavlqsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2orbI (I:)
    evhlvesggdlvkpggslklscaasgftfshygmswvrqtpdkrlewvatigsrgtythy
    pdsvkgrftisrdndknalylqmnslksedtamyycarrsamdywgqgasvtvssakttp
    psvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvps
    stwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2orbL (L:)
    divltqspaslavslgqratiscrasesvdnygfsfmnwfqqkpgqppklliyaisnrgs
    gvparfsgsgsgtdfslnihpveeddpamyfcqqtkevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2orbL (L:)
    divltqspaslavslgqratiscrasesvdsfmnwfqqkpgqppklliyaisnrgsgvpa
    rfsgsgsgtdfslnihpveeddpamyfcqqtkevpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2orbM (M:)
    divltqspaslavslgqratiscrasesvdnygfsfmnwfqqkpgqppklliyaisnrgs
    gvparfsgsgsgtdfslnihpveeddpamyfcqqtkevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2orbM (M:)
    divltqspaslavslgqratiscrasesvdmnwfqqkpgqppklliyaisnrgsgvparf
    sgsgsgtdfslnihpveeddpamyfcqqtevpwtfgggtkleikradaaptvsifppsse
    qltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltltk
    deyerhnsytceathktstspivksfnrne