PDB entry 2or8

View 2or8 on RCSB PDB site
Description: Tim-1
Class: immune system
Keywords: Beta barrel, immunoglobulin fold, IgV domain, TIM, IMMUNE SYSTEM
Deposited on 2007-02-02, released 2007-04-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hepatitis A virus cellular receptor 1 homolog
  Species: Mus musculus [TaxId:10090]
  Gene: Havcr1, Tim1, Timd1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5QNS5 (1-111)
    • initiating methionine (0)
    • cloning artifact (112-115)
  Domains in SCOPe 2.04: d2or8a_
• Chain 'B':
  Compound: Hepatitis A virus cellular receptor 1 homolog
  Species: Mus musculus [TaxId:10090]
  Gene: Havcr1, Tim1, Timd1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5QNS5 (1-111)
    • initiating methionine (0)
    • cloning artifact (112-115)
  Domains in SCOPe 2.04: d2or8b_
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2or8A (A:)
  mdsyvevkgvvghpvtlpctystyrgitttcwgrgqcpssacqntliwtnghrvtyqkss
  rynlkghisegdvsltiensvesdsglyccrveipgwfndqkvtfslqvkpelvpr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2or8B (B:)
  mdsyvevkgvvghpvtlpctystyrgitttcwgrgqcpssacqntliwtnghrvtyqkss
  rynlkghisegdvsltiensvesdsglyccrveipgwfndqkvtfslqvkpelvpr