PDB entry 2or7

View 2or7 on RCSB PDB site
Description: Tim-2
Class: immune system
Keywords: Beta barrel, immunoglobulin fold, IgV domain, TIM, IMMUNE SYSTEM
Deposited on 2007-02-02, released 2007-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: T-cell immunoglobulin and mucin domain-containing protein 2
  Species: Mus musculus [TaxId:10090]
  Gene: Timd2, Tim2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8R183 (Start-110)
    • see remark 999 (61)
    • cloning artifact (111)
  Domains in SCOPe 2.08: d2or7a1, d2or7a2
• Chain 'B':
  Compound: T-cell immunoglobulin and mucin domain-containing protein 2
  Species: Mus musculus [TaxId:10090]
  Gene: Timd2, Tim2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8R183 (1-110)
    • initiating methionine (0)
    • see remark 999 (61)
    • cloning artifact (111-114)
  Domains in SCOPe 2.08: d2or7b1, d2or7b2
• Heterogens: ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2or7A (A:)
  meshtavqglaghpvtlpciysthlggivpmcwglgecrhsycirsliwtngytvthqrn
  sryqlkgnisegnvsltientvvgdggpyccvveipgafhfvdymlevkpelvpr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2or7A (A:)
  avqglaghpvtlpciysthlggivpmcwglgecrhsycirsliwtngytvthqrnsryql
  kgnisegnvsltientvvgdggpyccvveipgafhfvdymlevkpel
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2or7B (B:)
  meshtavqglaghpvtlpciysthlggivpmcwglgecrhsycirsliwtngytvthqrn
  sryqlkgnisegnvsltientvvgdggpyccvveipgafhfvdymlevkpelvpr