PDB entry 2or1

View 2or1 on RCSB PDB site
Description: recognition of a DNA operator by the repressor of phage 434. a view at high resolution
Class: gene regulation/DNA
Keywords: protein-DNA complex, double helix
Deposited on 1989-09-05, released 1989-09-05
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*ap*gp*tp*ap*cp*ap*ap*ap*cp*tp*tp*tp*cp*tp*tp*g p*tp*ap*t)-3')
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*tp*ap*cp*ap*ap*gp*ap*ap*ap*gp*tp*tp*tp*gp*t p*ap*cp*t)-3')
  • Chain 'L':
    Compound: 434 repressor
    Species: Bacteriophage 434
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2or1l_
  • Chain 'R':
    Compound: 434 repressor
    Species: Bacteriophage 434
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2or1r_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2or1L (L:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngtsdsnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2or1L (L:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngt
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2or1R (R:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngtsdsnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2or1R (R:)
    sissrvkskriqlglnqaelaqkvgttqqsieqlengktkrprflpelasalgvsvdwll
    ngt