PDB entry 2oqu

View 2oqu on RCSB PDB site
Description: High Pressure Cryocooling of Capillary Sample Cryoprotection and Diffraction Phasing at Long Wavelengths
Class: hydrolase
Keywords: high pressure cryocooling, Xenon, SAD phasing, HYDROLASE
Deposited on 2007-02-01, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elastase-1
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2oqua_
  • Heterogens: CA, SO4, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oquA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn