PDB entry 2oqr

View 2oqr on RCSB PDB site
Description: The structure of the response regulator RegX3 from Mycobacterium tuberculosis
Class: transcription,signaling protein
Keywords: response regulator, winged-helix-turn-helix, dna-binding, 3D domain swapping, RegX3, two component system, TRANSCRIPTION,SIGNALING PROTEIN
Deposited on 2007-02-01, released 2007-10-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.179
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensory transduction protein regX3
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: regX3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q11156 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.06: d2oqra1, d2oqra2, d2oqra3
  • Heterogens: ACT, LA, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2oqrA (A:)
    gamatsvlivedeesladplafllrkegfeatvvtdgpaalaefdragadivlldlmlpg
    msgtdvckqlrarssvpvimvtardseidkvvglelgaddyvtkpysareliariravlr
    rggdddsemsdgvlesgpvrmdverhvvsvngdtitlplkefdlleylmrnsgrvltrgq
    lidrvwgadyvgdtktldvhvkrlrskieadpanpvhlvtvrglgykleg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2oqrA (A:)
    atsvlivedeesladplafllrkegfeatvvtdgpaalaefdragadivlldlmlpgmsg
    tdvckqlrarssvpvimvtardseidkvvglelgaddyvtkpysareliariravlrrgg
    dddsemsdgvlesgpvrmdverhvvsvngdtitlplkefdlleylmrnsgrvltrgqlid
    rvwgadyvgdtktldvhvkrlrskieadpanpvhlvtvrglgykle